PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g046890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family TALE
Protein Properties Length: 528aa    MW: 60260.5 Da    PI: 6.7748
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g046890.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-093714081954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+++e+  L+k++gL+++qV +WF N R +
  Csa07g046890.1 371 FEHflHPYPKESEKIMLSKQTGLSKNQVANWFINARVR 408
                     665559******************************88 PP

2BELL125.42.2e-40234305172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+v+glg+akpYts+Al++iSrhFrcL+dai+eqi
  Csa07g046890.1 234 ERQELQNKKSKLLTMVDEVDKRYNQYHHQMEALASSFEMVTGLGAAKPYTSVALNRISRHFRCLRDAIKEQI 305
                     79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-51164303IPR006563POX domain
PfamPF075261.0E-47170301IPR006563POX domain
PROSITE profilePS5007112.066349412IPR001356Homeobox domain
CDDcd000863.63E-11352413No hitNo description
SMARTSM003891.9E-9352416IPR001356Homeobox domain
SuperFamilySSF466893.42E-17353419IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28355418IPR009057Homeodomain-like
PfamPF059201.8E-17369408IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MAVYYPNSVG MQSMYHESIY LNEQQQQASS SSAASFSEIV SGDVRHNEMV FIPPTTSDVA  60
VNGNVTVSSN DLSFHGGGLS LSLGNQIQSA VSVSPFQYHY QNLSNQLNYN NASTMSSDEN  120
GKSLSGHHHY HQQQQHHSDQ MIPSSGYNNN NGVGFYNNYR YETSGFVSSV LRSRYLKPTQ  180
QLLDEVVSVR KELKLGNKKM KNDKGQDFQN GSSDNNIKED EKPQPQPQEL SPSERQELQN  240
KKSKLLTMVD EVDKRYNQYH HQMEALASSF EMVTGLGAAK PYTSVALNRI SRHFRCLRDA  300
IKEQIQVIRG KLGERETSDE QGERIPRLRY LDQRLRQQRA LHQQLGMVRP AWRPQRGLPE  360
NSVSILRAWL FEHFLHPYPK ESEKIMLSKQ TGLSKNQVAN WFINARVRLW KPMIEEMYKE  420
EFGDSELETN SNQDNNKMQE TSQLKHEESS SQQQNQGNNN NNIAYTSDAG ENLVFADPKP  480
DRATTAEYDS LMNYHGFGID DYNRYVGLGN QQDARFSNPH QLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-15358416563Homeobox protein Meis2
3k2a_A1e-15358416563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3530930.0AF353093.1 Arabidopsis thaliana BEL1-like homeodomain 3 (BLH3) mRNA, complete cds.
GenBankAY0625450.0AY062545.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410; F1B16.6) mRNA, complete cds.
GenBankAY0852780.0AY085278.1 Arabidopsis thaliana clone 142443 mRNA, complete sequence.
GenBankAY5984520.0AY598452.1 Arabidopsis thaliana BEL1-like homeodomain 3 protein mRNA, complete cds.
GenBankBT0001330.0BT000133.1 Arabidopsis thaliana Similar to homeodomain proteins (At1g75410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010416424.10.0PREDICTED: BEL1-like homeodomain protein 3
SwissprotQ9FWS90.0BLH3_ARATH; BEL1-like homeodomain protein 3
TrEMBLR0IEB00.0R0IEB0_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1821__AT1G75410.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75410.20.0BEL1-like homeodomain 3